<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7165 14.ZA.WC391 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, G16E, L19I, M36L, R41K, L63A, H69K, T74A, L89M, I93L  
>14.ZA.WC391| codons 1-99
PQITLWQRPLVTIRVEGQIKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, V106M, G190A   P4S, K20R, E28K, K32E, V35T, E36A, T39E, S48T, V60I, I94L, D123E, K173A, Q174K, D177E, I178L, T200A, Q207E, F214L, V245Q  
>14.ZA.WC391| codons 1-258
PISSIETVPVKLKPGMDGPRVKQWPLTKEKIEALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGLPHPAGLEKKKSMTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
YQYVDDLYVASDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQ

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017