<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14547 CA33899 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 AZT+DDC 17
3 AZT 47
4 3TC+AZT 13
5 3TC+AZT+IDV 69
6 AZT+NFV+NVP 8
7 D4T+DDI+NFV+NVP 47
8 3TC+AZT+EFV+NFV 26
9 ABC+AZT+DDI+RTV+SQV 17
10 ABC+APV+D4T+NVP 95
11 AZT+3TC+IDV 8
12 3TC+APV+AZT+EFV 26
13 3TC+AZT+NFV+NVP+TDF 30
14 None 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I54V, V82A L10F, K43KT I15V, N37X, R41RK, L63P, A71V, I85V  
>CA33899| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADDTILEEMXLPGKWTPKLIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y K219R K101E, Y181V, G190A A98G, V108I T39A, E44D, V106I, V118I, V179I, E203K, H208Y, R211D, K223Q, A272P, K277R, I293V, E297K, I329V, M357MT, V365I, A400T, W410WC, V435A, T450S, L452V, D460N, R461K, S468T, Q509QH, Q524E, A554S I159L
>CA34914| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSITILDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPALFQSSMTKILEPFRKQNPDIII
VQYVDDLYVASDLEIGQHRTKIKELRQYLWDWGFYTPDRKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDIKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATCIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRESKVGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAHPDKSESELVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005