<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8042 CA33868 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 63
2 AZT+DDI 10
3 3TC+AZT+IDV 166
4 ABC+D4T+EFV 163

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, E35D, N37D, R41K, I62V, L63P, A71T, I93L  
>CA33868| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMDLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y   Y188L   T39A, E44D, V90VI, V106I, T107S, V118I, K122E, I135T, I142V, S162C, V179I, T200K, I202V, E203D, Q207E, H208Y, H221Y, V245K  
>CA34883| codons 1-267
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSISVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLLVGSDLEIGQHRKKVDELREYLWRWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005