<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5632 CA33867 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 AZT+NFV+NVP 21
3 APV+RTV+ABC+EFV 26
4 AZT+3TC+LPV+EFV 85

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M G73S T12TK, I15V, K20I, R57K, Q61R, I62V, L63P, C67F, H69K, A71V, I72L  
>CA33867| codons 1-99
PQITLWQRPLVKIKVGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVKQYD
RVPIEIFGKKVLSTVVVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   V106A, G190A F227L L109I, K122E, V179I, I202V, D218E, L228LR, A272P, K277R, Q278H, I293V, E297K  
>CA34882| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVIDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVASDLEIGQHRTKVEELRQHLLRWGFYTPEKKHQKEPPLRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVVPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005