<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4330 14.ZA.GT3571 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184I A62V K103N, Y181V   V35T, T39D, S68G, V90I, K122E, D123N, E138G, I142V, K173A, D177E, T200A, R211K, V245Q, K249Q  
>14.ZA.GT3571| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPV
FVIKRKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNGTPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
VQYIDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEQDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16A, L19V, E35D, M36I, N37NS, R41K, R57K, H69K, V82I, L89M, I93L  
>14.ZA.GT3571| codons 1-99
PQITLWQRPLVSIKVAGQVKEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017
Rhee, SY Mutational Correlates of Virological Failure in Individuals Receiving a WHO-Recommended Tenofovir-Containing First-Line Regimen: An International Collaboration. EBioMedicine, 2017