<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5140 CA33854 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 143
2 3TC+ AZT+ NFV 39
3 3TC+ ABC+ D4T+ EFV 52
4 None 39
5 3TC+ ABC+ D4T+ NVP 54

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   K20I, N37E, L63S, A71V, T74S, V77I, I93L  
>CA33854| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMELPGRWKPKLIGGIGGFIKVRQYD
QISIEICGHKVIGSVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, L74LV, M184V, T215Y   K103N, M230ML V108VI E6EK, I31IL, I135V, S162C, V189VI, T200A, E203K, K223KT, V292I  
>CA34868| codons 1-299
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYIGSDLEIGQHRAKIKELRQHLLRWGFYTPDKKHQTEPPFLWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIIPLTEEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005