<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6361 CA33836 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 AZT+DDI 30
3 3TC+AZT+IDV 205
4 3TC+ABC+AZT+IDV 43
5 ABC+D4T+RTV+SQV 79

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90LM V11VI, F53FL, Q58QE, N88T L10I, I13V, I15V, Q18H, L19I, K20I, M36I, K70R, A71V, I72M  
>CA33836| codons 1-99
PQITLWQRPIITVKVGGHIIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGLIKVREYD
QILIEICGHRVMGTVLVGPTPVNVIGRTLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       E6ED, K20R, T39AE, K104KN, K122E, I135IV, Q207E, E248D, T286A, E297K, I326V, G359S, A371V, I375V, A376S, T377Q, T386I, T403M, V435A, A446S, V466I, K476KQ, Q524E  
>CA34843| codons 1-560
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKVSQESIVIWGKIPKFKLPIQKETWEAWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGASNRETKLGKAGYVTDRGRQKIVSLTDTTNQQTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005