<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1151 14.ZA.EC949 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   K103N, Y181C V108I, P225H, F227FL V35I, T39E, S48T, K122E, D123E, K173A, Q174K, D177E, I178L, T200A, Q207D, R211K, H221Y, V241I, P243T, V245Q, D250E  
>14.ZA.EC949| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAFFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPELVI
CQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKYQKEHPLLWMGYELHPDKWT
IQTIQLPEKESWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, K20R, M36I, R41K, L63A, H69K, L89M, I93L  
>14.ZA.EC949| codons 1-99
PQITLWQRPLVTIKIGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017