<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
458 13.ZA.WC344 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75VM   E138K P4PS, V35T, T39E, E40ED, S48T, V60I, K101Q, K122E, D123G, K173A, T200A, I202IV, Q207EG, R211K, F214L, V245Q  
>13.ZA.WC344| codons 1-258
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEDMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPDIVI
YQYMDDLYVGSDLEIGQHRAKVEELRGHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, K14IT, I15V, L19T, K20R, M36I, R41K, H69K, L89M, I93L  
>13.ZA.WC344| codons 1-99
PQITLWQRPLVSITVGGQTREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017