<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14487 CA33793 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 255

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L76V K43T L19Q, N37Y, I62V, L63P, I72IV, I93L  
>CA33793| codons 1-99
PQITLWQRPLVTIKIGGQQKEALLDTGADDTVLEEMYLPGRWTPKLIGGIGGFIKVRQYD
QVPIEICGHKAVGTVVVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215TI, K219Q     K20R, T39A, A98S, K104N, D123E, K166R, D177E, T200E, F214L, V245E, A272P, I293V, S322T, G333E, G359S, A360T, T369V, K390R, E399D, A400T, E449D, L452V, D460N, R461K, S468T, H483Y, Q524E, A534S, I556V, K558R  
>CA34805| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKNSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHREKIEELRQHLLRWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMRST
HTNDVKQLVEAVQKIATESIVIWGKTPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRDTKVGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGVRRVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005