<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1854 14.ZA.GT3474 South Africa 2014 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N   V35T, E36A, T39E, S48T, V60I, K101Q, K122E, D123G, K166R, K173A, D177E, T200A, Q207E, R211K, V245Q  
>14.ZA.GT3474| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, R41K, L63A, H69Q, I93L  
>14.ZA.GT3474| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGQKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017