<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14227 CA33720 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+EFV 39
2 AZT+LPV+TDF 12
3 D4T+DDI+LPV+TDF 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F I13V, N37S, P39S, L63A, I72IV, V77I, L89M  
>CA33720| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEEMSLSGRWKPKMIGGIGGFIKVRQYD
QIAIEICGHKAVGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T215Y   K103KN, G190GA   K49KR, V60VI, R83K, K122KE, E169D, T200I, I202V, L210F, R211K, S251T, I293V, E297A  
>CA34733| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRIKVEELRQHLFKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDTWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005