<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7950 CA33681 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 48
2 3TC+D4T+NFV 187
3 D4T+DDI+IDV+RTV 79

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V L10F, N88D I13V, E35D, M36I, N37C, I62V, L63P, A71T, I93L  
>CA33681| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADNTVLEDICLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MIV, T215F       K20R, V118I, K122E, I142V, T200A, R211K, F214L, T286A, A288T, E297Q, K311R, D324E, R356K, M357R, G359S, A360T, K390R, A400T, K451R, V458I, D460N, R461K, S468P, K476Q, L491S, A554S  
>CA34706| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTEVIPLTQEAE
LELAENREILREPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKRRST
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRLGKAGYITNKGRQKVVPLTDTTNQQTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005