<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4861 CA33670 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 35
2 3TC+AZT+IDV 82
3 None 39
4 3TC+D4T+SQV 8
5 D4T+EFV+NFV+NVP 23
6 ABC+APV+DDI 29
7 D4T+RTV+SQV 22
8 ABC+APV+D4T+RTV 92

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54LV, V82A, I84V L33F L10I, I13V, K20KT, E35D, N37D, K55R, R57K, D60E, I62V, L63T, I64IV, I66F, A71V, T91S, I93V, F99L  
>CA33670| codons 1-99
PQITLWQRPIVTVKIGGQLTEALLDTGADDTVFEDMDLPGRWKPKLIGGIGGFLRVKQYE
QVTVEFCGHKVIGTVLVGPTPANVIGRNLLSQVGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215F K219Q     V35T, E44ED, V60VI, K104KN, D123E, I167IV, I202IV, H208HY, R211K, D218E, V245K, A272P, T286A, I293V, E297K  
>CA34685| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQYLWKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009