<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2925 10.ZA.GT1162 South Africa 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, E36A, T39E, S48T, A98S, D121Y, K122E, E138A, I142V, E169Q, K173T, Q174E, V179I, T200A, I202V, Q207E, V245C  
>10.ZA.GT1162| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILQPFRTENPDIII
YQYMDDLYVGSDLEIGQHRAKVEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPICLPEKDSW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36L, R41K, D60E, L63P, C67G, H69K, L89M, I93L  
>10.ZA.GT1162| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYE
QIPIEIGGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Van Zyl, GU Trends in genotypic HIV-1 antiretroviral resistance between 2006 and 2012 in South African patients receiving first- and second-line antiretroviral treatment regimens. PLoS ONE , 2013
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017