<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4450 CA33665 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 261
2 3TC+AZT+IDV 19
3 D4T+DDI+NFV+NVP 21
4 3TC+D4T+DDI+NFV+NVP 152

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM N88D I13V, E35D, M36I, D60DE, I62V, L63AP, I64IM, A71V  
>CA33665| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYE
QVAMEICGHKVIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69T_N, K70R, M184V D67G, K219Q     K11KR, K20R, V35I, K49R, K64N, D123DN, I135T, T165I, D177E, I195L, T200TA, F214L, D218E, V245T, K277R, Q278H, A288S, I293V, P294T, E297K S68Y
>CA34675| codons 1-299
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISRIGPENPYNTPV
FAINKKGYTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYVDDLYVGSDLELGQHRAKIEELRQHLLRWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGTKSLTEVVTLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005