<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6792 CA33657 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 104
2 3TC+D4T+IDV 57
3 D4T+EFV+RTV+SQV 30
4 3TC+D4T+NFV+NVP 52
5 ABC+D4T+DLV+SQV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M F53L K20R, M36I, L63P, A71V, I93L  
>CA33657| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTILEEINLPGRWKPKIIGGIGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T215Y   K103N   T39A, K122E, I135V, I142V, A272S, K277R, Q278E, I293V, E297K Y232H
>CA34673| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGHELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVRELCKLLRGTKALTEVVPLTKEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005