<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4439 CA33656 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 88
2 AZT+DDC 70
3 3TC+D4T 15
4 3TC+D4T+IDV 22
5 3TC+D4T+NFV 97
6 ABC+RTV+SQV 36
7 APV+DDI+EFV+RTV 113

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M Q58E L63P  
>CA33656| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFMKVREYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219N K101E, Y181C   V35I, I50IV, R83K, K122P, K166R, D177E, A272P, V276I, I293V, L303W, E305K E302D, A304Q, N306T, R307E
>CA34671| codons 1-307
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRGTKALTEVVPLTEEAE
LDWQKTE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009