<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5110 CA33644 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 157
2 D4T+DDI+EFV 35
3 ABC+D4T+IDV+RTV 17
4 ABC+D4T+NFV 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46MI N88ND L10V, T12I, I15V, E35D, N37D, A71AV  
>CA33644| codons 1-99
PQITLWQRPVVIIKVGGQLKEALLDTGADNTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QILIEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210LW, T215Y   K103N   K20R, T39TA, V60I, D123E, I135T, I142V, Q207A, R211K, L228LR, D250E, A272P, K277R, T286A, I293V, E297K  
>CA34663| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005