<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5294 CA33634 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 7
2 NRTI 106
3 3TC+D4T+IDV 52
4 IDV 8
5 None 5
6 3TC+AZT+NVP 40
7 3TC+ABC+AZT+NVP 67
8 Unknown 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I Q7D, L10I, I15V, L19I, E35D, N37T, R41K, I62IV, L63P, A71V  
>CA33634| codons 1-99
PQITLWDRPIVTIKVGGQIKEALIDTGADDTVLEDMTLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181YC, G190GA   K20R, D123E, I135R, I142IV, S162C, D177E, V189VI, E203D, R211K, V245M, A272P, T286A, I293IV, E297A  
>CA34650| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSRNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYVDDLYIASDLEIGQHRTKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005