<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6404 CA33633 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 14
2 3TC+D4T 45
3 3TC+D4T+IDV 82
4 3TC+D4T+EFV 109

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V L33I I13V, L19P, K20I, M36I, I64V  
>CA33633| codons 1-99
PQITLWQRPLVTVKIGGQPIEALLDTGADDTVIEEINLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHKAIGTVVVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V N348I K103N, Y188L   K102R, K122E, I135V, F214FL, A272P, K277R, Q278H, I293V, E297A, I329V, T397TA, E404D, D460N, V467I, H483Y, L491S, K527N, A554T, I556V  
>CA34649| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKEAWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSTGVRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005