<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14383 CA33627 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 313
2 DDI 57
3 AZT+DDI 21
4 3TC+D4T+RTV 61
5 3TC+D4T+IDV 82
6 3TC+D4T+NVP+RTV+SQV 212

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, T12TA, I13V, K20KM, N37ND, L63P, A71V, I72IV, V77I, I93L  
>CA33627| codons 1-99
PQITLWQRPIVAVKIGGQLMEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVVSTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, M184V, L210W, T215F K219W G190A K101H T39N, K43Q, V60I, V118I, K122E, I135T, I142V, G196E, H208Y, R211K, L228H, V245VE, A272AP, K277R, L283I, A288S, I293V, E297K, E312EA, G333E, G335S, R356RK, A360AT, A376AT, T377TM, S379C, K390R, A400T, T403AS, E404ED, V435E, A437AV, D460N, V466VI, T470P, H483HY, L491S, E516ED, Q524E, V548I, A554S  
>CA34643| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICNELEQEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIEQHRTKIEELRQYLWKWGFFTPDWKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKSLTEVVPLTKEAE
LELAENREILKAPVHGVYYDPSKDLIAEIQKQEQSQWTYQIYQEPFKNLKTGKYAKMRGT
HTNDVKQLTEAVQKITMECIVIWGKTPKFRLPIQKETWETWWSDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIEGVETFYVDGAANRETKLGKAGYVTNRGRQKIVSLPDTTNQKTELQ
AIYLALQDSGSEVNIVTDSQYALGIIQAQPDKSESDLVSQIIEELIKKEKVYLAWVPAHK
GIGGNEQIDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005