<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7971 CA33593 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NFV 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML   L19Q, A71T, V77I  
>CA33593| codons 1-99
PQITLWQRPLVTIKIGGQQKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QILIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV     E6EG, R83K, K103R, D123E, S162C, D177E, T200A, P243S, V245E, A272P, K281R, T286A, V292I, I293V, M357T, R358RK, T369V, A376T, T386S, E399D, A400T, Y405H, A446S, D460N, R461K, S468T, H483Y, Q509I, Q520R, Q524E, A554N  
>CA34609| codons 1-560
PISPIGTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQSIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLVEAVQKITTESIVIWGKSPKFKLPIQKETWDTWWTEHWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGASNRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAIPDKSESELVSRIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005