<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8082 CA33584 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 AZT+DDI+SQV 113
3 3TC+AZT+SQV 39
4 D4T+DDI+EFV 92
5 3TC+APV+DDI 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A Q58QE L10I, I15V, G16E, K20KT, R41RK, I54X, L63C, T74X, V77I, I93L  
>CA33584| codons 1-99
PQITLWQRPIVTIKVEGQLTEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFXKVREYD
QICIEICGHKAIGXVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LV, M184V, T215Y K219Q K103N   V60VI, K122E, A158S, I202V, L228H, I293IV  
>CA34599| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005