<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14357 CA33582 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 35
2 3TC+AZT 104
3 3TC+D4T+IDV 56
4 D4T+DDI+EFV 153

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18QE, N37NS, L63T, V77VI  
>CA33582| codons 14-99
KIGGELKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQITIEICGHKAIG
TVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K65KR, M184MV, L210LW   K103N   K43KQ, E44ED, S68G, K101Q, K122E, D123N, I135T, D177EG, I178X, V179X, T200TA, T215X, D218DE, E248V, A272P, P294T  
>CA34598| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEXXI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFXTPEKKHQKEPPFLWMGYELHPDKWT
VQPIVLPVKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVITLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005