<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4409 CA33574 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 79
2 AZT+DDI 31
3 3TC+AZT+IDV 74
4 APV+D4T+NVP 9
5 DDI+RTV+SQV 27
6 3TC+D4T 30
7 3TC+ABC+D4T 18
8 Unknown 145

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, I13V, K14KR, I15V, I62V, I64V, I72V, V77I  
>CA33574| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVLVEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70KR     V179VE K122E, D123E, I135T, S162Y, T200E, R211K, F214FL, L228LH, T286A, I293IV, E297K  
>CA34586| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIEI
YQYMDDLYVGSDLEIGQHREKIEELRQHLLKWGLTTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005