<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2204 CA33562 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 100
2 AZT+DDI+NFV 39
3 3TC+D4T+NVP 87
4 3TC+D4T+IDV 72
5 3TC+ABC+APV+D4T 37
6 APV+D4T+DDI+RTV 43
7 3TC+APV+D4T+RTV+TDF 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L10F, L33F, N88D I15V, R41K, I62V, L63P, I66L, V77I, I93L, C95F  
>CA33562| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADDTVFEEMNLPGKWKPKIIGGIGGFIKVRQYD
QVPIELCGHKAIGTVLIGPTPVNVIGRDLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y N348I K103N   V35M, K43Q, E44D, D86N, V118I, E138Q, S162D, G196D, R211K, Q278H, T286A, I293V, E297R, K366R, S379G, K385KR, T386I, A400T, G436E, N447NS, D460N, V467I, L491S, S519ST, Q524E, A554T K13N, Y127YC
>CA34577| codons 1-560
PISPIETVPVKLNPGMDGPKVKQWPLTEEKIKALMEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQNFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKCTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIDQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVRQLTEAVQKIATEGIVIWGRIPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVEAETFYVDGAASRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVTQIIEELIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009