<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6470 CA33557 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 3TC+AZT+RTV 13
3 3TC+AZT+IDV 198
4 ABC+APV+D4T 102

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I47IV, I54V, V82A K43T, L89V L10I, I13V, K20V, M46X, L63P, A71T  
>CA33557| codons 1-99
PQITLWQRPIVTVKIGGQLVEALLDTGADDTVLEEMNLPGRWTPKXVGGIGGFVKVRQYD
QIPIEICGHKTIGTVLVGPTPANIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y K219KR     T39X, E40X, K43E, E44EA, V60I, V75X, V118VI, I142V, Q207E, H208HY, R211RK, Q278H, I293V, P294Q  
>CA34566| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICXXLEEAGKISKIGPENPYNTPI
FAIKKKNSDKWRKLXDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVQLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009