<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7051 12.ZA.EC151 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+LPV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   V35K, T39E, S48T, K101Q, K122KE, I135IM, K173T, Q174K, T200A, E203D, Q207A, R211K, V245N, E248D, D250E  
>12.ZA.EC151| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIDELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPINLPDKESWTVNDIQKLV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, L19I, E35G, M36I, N37D, R41K, D60E, Q61QE, I62V, L63P, C67S, H69K, L89M, I93L  
>12.ZA.EC151| codons 1-99
PQITLWQRPLVTIRVGGQIKEALLDTGADDTVLEGIDLPGKWKPKMIGGIGGFIKVRQYE
EVPIEISGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Van Zyl, GU Trends in genotypic HIV-1 antiretroviral resistance between 2006 and 2012 in South African patients receiving first- and second-line antiretroviral treatment regimens. PLoS ONE , 2013
Posada Cespedes, S Learning evolutionary pathways of HIV-1 subtype C under lopinavir treatment IAS 2017, 2017