<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9807 CA33538 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 83
2 3TC+ABC+AZT+NFV 138

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10LF I13IV, G16E, K20KR, E35D, M36I, I62V, L63A, I64V, K70KR, V75I  
>CA33538| codons 1-99
PQITLWQRPFVTVKIEGQLREALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVAVEICGHRAIGTILVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215FY K219E, N348I     T7TA, K102Q, K122E, I135V, S162C, K277R, R284K, E297K, I326V, I329L, K385R, K390R, E399D, A400T, K431R, V435A, K454R, Q547R, V548I, A554N  
>CA34551| codons 1-560
PISPIEAVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLKGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAELQKQGQGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGRTPKFRLPIQKETWDTWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEREPIAGAETFYVDGAANRETKLGRAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNERIDKLVSNGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005