<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4057 CA33519 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 3TC+AZT+IDV 22
3 3TC+ABC+ADV+APV+Unknown 31
4 3TC+APV+Unknown 196
5 Unknown 87
6 3TC+ABC+APV+LPV 41

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10F, V11I, L24I, L89V T12P, I13V, K20M, M36I, I62V, L63P, C67Y, A71V, I72M, I93L  
>CA33519| codons 1-99
PQITLWQRPFIPVKIGGQLMEALIDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QVPIEIYGHKVMGTVLVGPTPANIIGRNVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   Y181C V108I, F227L P4PH, I5IV, K20R, V35L, T39TA, E44ED, K122E, I135T, I167IV, T200A, E203K, Q207E, R211RK, K223E, A272P, T286A, E297K  
>CA34537| codons 1-302
PISHVETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIKELREHLWKWGFYTPDKKHQEEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005