<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4128 CA33490 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 13
2 3TC+D4T 44
3 3TC+D4T+IDV 26
4 3TC+D4T+NFV 91
5 D4T+RTV+SQV 149

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54IL, I84V, L90LM L10F, N88D I13V, K20T, L33V, I64V, A71V  
>CA33490| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADNTVVEEMNLPGRWKPKMIGGIGGFLKVRQYD
QILVEICGHKVIGTVLVGPTPVNVIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       V35T, K43E, K102KE, V118VI, K122E, D123E, D177E, R211RK, V292VI, I293V  
>CA34494| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE

References
Author Title Citation
Mitsuya, Y N88D facilitates the co-occurrence of D30N and L90M and the development of multidrug resistance in HIV type 1 protease following nelfinavir treatment failure. ARHR, 2006