<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5114 CA33483 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+IDV 18
2 D4T+DDI+NFV 44
3 None 70
4 3TC+AZT+NFV 127

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10IV, M36MI, R41RK, Q61E, L63P, I64V, K70T, A71V, T74S, I93L  
>CA33483| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEINLPGKWKPKLIGGIGGFVKVRQYD
EIPVEICGHTVIGSVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_ST, M184V, L210LW, T215F       E44ED, V118I, I135T, T165L, E169EK, K173E, T200A, F214L, A272P, K281R, T286A, E297K  
>CA34495| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMLKILKPFREQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005