<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4516 CA33480 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 5
2 3TC+AZT+SQV 6
3 3TC+AZT+IDV 9
4 3TC+D4T+IDV 101
5 NVP+DDI+NFV 7
6 DLV+DDI+NFV 29
7 EFV+DDI+NFV 32
8 ABC+D4T+Unknown+APV+NFV NA
9 Unknown 90

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, K43T K55KR, D60N, L63P, A71V, I93L  
>CA33480| codons 16-99
GGQLKEALIDTGADDTVLEEMNLPGRWTPKIIGGIGGFVRVRQYNQIPIEICGHKVIGTV
LVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN   A98S, D123E, I142V, I178L, V179I, I195IL, G196E, T200A, R211K, A272S, T286A, V292I, E297K  
>CA34488| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLII
YQYVDDLYVGSDLELEQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGAKALTEIIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005