<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4417 13.ZA.EC728 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V K219KR K101E, V106M F227L K20R, V35T, E36A, T39D, K122E, D123S, I135T, K173A, Q174K, D177E, T200A, Q207E, V245Q, E248EK  
>13.ZA.EC728| codons 1-257
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICDEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDRKHQKEPPLLWMGYELHPDKWT
VQPIQLPKKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, M36I, N37S, R41K, L63P, H69K, I72V, V77I, L89M, I93L  
>13.ZA.EC728| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAVGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Neogi, U Mutational Heterogeneity in p6 Gag Late Assembly (L) Domains in HIV-1 Subtype C Viruses from South Africa. ARHR, 2016