<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
5509 13.ZA.EC553 South Africa 2013 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V, T215Y A62V, K70N, V75T K103N, V106M F227L V35T, E36A, T39E, S48T, S68G, K122E, D123E, I135T, K173A, D177E, T200A, Q207E, V245Q  
>13.ZA.EC553| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FVIKKKDGTNWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKNKSMTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFYTPDKKHQKEPPLLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19V, K20R, M36I, N37S, Q61E, L63P, H69K, V77I, L89M, I93L  
>13.ZA.EC553| codons 1-99
PQITLWQRPLVSIKVGGQVREALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Neogi, U Mutational Heterogeneity in p6 Gag Late Assembly (L) Domains in HIV-1 Subtype C Viruses from South Africa. ARHR, 2016