<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1332 CA3346 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 52
2 3TC+AZT+IDV 34
3 3TC+AZT+NFV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V   L10I, T12P, G16E, L19I, E35D, M36MI, N37D, L63T, C67Y, A71T, I72T, I93L  
>CA3346| codons 1-99
PQITLWQRPIVPIKIEGQIKEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QITIEIYGHKTTGTVLVGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     A98G V21I, V35E, T39A, K122E, I135K, S162C, T200A, R211K, L283I, I293V  
>CA3345| codons 1-303
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LEL

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005