<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14266 CA33433 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+DDC 100
2 3TC+AZT+DDC+IDV 8
3 3TC+AZT+IDV 78
4 3TC+D4T+NFV 39
5 3TC+D4T+RTV+SQV 90

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S, L90M F53FL L10I, I13V, K14R, N37D, L63P, A71IT, I72X, V77VI, I93L  
>CA33433| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLIKVRQYD
QIPIEICGHKIXGTVLIGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, V60VI, D123E, I135IV, D177E, T200I, V245E, I293V, E297A  
>CA34458| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009