<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1313 CA33420 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+AZT 52
3 AZT+DDI+SQV 30
4 3TC+D4T+NFV 25
5 3TC+D4T+NVP+IDV 46
6 3TC+D4T+IDV 204

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, K20I, D60E, I62V, L63P, H69HY, A71T, I72E, G73X, V77I, I93L  
>CA33420| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QVPIEICGYKTEXTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       M16MV, K20R, T39A, K49KR, V60I, R83K, V90VI, V118VI, K122KE, I135T, S162X, E169D, G196E, I202V, Q207E, R211K, A272P, I293V  
>CA34436| codons 1-301
PISPIETVPVKLKPGVDGPRVKQWPLTEEKIKALVEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKVEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005