<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9777 CA33416 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 165
2 D4T+DDI+RTV+SQV 52
3 3TC+ABC+APV+DLV+EFV+IDV 52
4 3TC+ABC+APV+RTV 17
5 None 53
6 3TC+ABC+APV+RTV 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, V82A, L90M L33F L10I, I13V, K14R, I15V, D60E, I62V, L63P, C67E, A71AV, I72V, V77I  
>CA33416| codons 1-99
PQITLWQRPIVTVRVGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFMKVRQYE
QVPIEIEGHKVVGTVLIGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y K219R     K20R, T39A, K43E, V118I, S162C, E169D, D177E, G196E, E203K, Q207E, R211K, K223E, L228R, V245E, A272P, E297T K126P
>CA34432| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRPYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIKELREHLWKWGFYTPDRKHQEEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTTEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005