<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1809 CA33413 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 156
2 D4T+ 3TC 52
3 NFV+ 3TC+ D4T 88
4 SQV+ EFV+ DDI 23
5 None 62
6 Unknown 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I   I13V, K14R, I15V, K20T, R41K, I64V, V77I, I93L  
>CA33413| codons 1-99
PQITLWQRPLVTVRVGGQLTEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219Q V106A   T69N, I135L, G196E, R211K, F214L  
>CA34428| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGLVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005