<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4285 CA33375 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 165
2 3TC+AZT 59
3 D4T+DDI+IDV 97
4 D4T+DDI+IDV+RTV 144

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   N37T, R57K, D60E, Q61E, L63P, V77I, I85V, I93L  
>CA33375| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKLIGGIGGFIKVKQYE
EIPIEICGHKAIGTVLIGPTPVNIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       M16L, K20R, I135V, S162C, T200A, E203D, R211Q, T286A, I293V, E297A  
>CA34392| codons 1-301
PISPIETVPVKLKPGLDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIDELRQHLLQWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005