<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14233 CA33365 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+SQV 104
2 3TC+D4T 31
3 ABC+EFV+NFV+RTV 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S L10I, I15V, Q18QH, L19I, K20T, E35ED, M36I, L63P, I66IV, A71X, I85V  
>CA33365| codons 1-99
PQITLWQRPIVTIKVGGHITEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEVCGHKXISTVLVGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, M184V T215I, K219E K103N L234LI E6D, V60I, V90VI, V108X, K122E, D123N, I142V, Q174QR, I202V, Q207E, L228R, A272P, T286A, E297K  
>CA34380| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTXLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELREHLLRWGFITPDEKHQKEPPFRWMGYEIHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005