<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA364 CA33351 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV 28
2 D4T 117
3 3TC+D4T+NFV 109
4 None 63
5 3TC+D4T+NVP 2
6 3TC+D4T+NFV 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I15V, K20T, E35D, M36I, N37D, I62V, L63P, I64IM, A71V, T74S, I93L  
>CA33351| codons 1-99
PQITLWQRPLVTIKVGGQLTEALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVPMEICGHKVIGSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20KR, I135V, S162C, G196GV, Q207X, R211K, E248ED, A272P, K277R, I293IV, E297K  
>CA34366| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIVQHRTKIEELRXHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005