<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14225 CA33348 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 AZT+DDC 57
3 3TC+AZT+IDV 69
4 D4T+DDC+NFV 242

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, M36I, L63P, I64V, A71V, I93L  
>CA33348| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEINLPGRWKPKLIGGIGGFVKVRQYD
QIPVEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L210W, T215Y D67G, K219R, N348I     E6D, V60VI, V118I, K122E, D123E, I135V, I142V, S162C, R211K, V245K, I293V, M357T, T369A, A400I, K451R, S468P, L469I, T470EK  
>CA34363| codons 1-560
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKGSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARTRGA
HTNDVKQLAEAVQKIATESIVIWGKTPKFKLPIQKETWEIWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRLGKAGYVTDRGRQKVVPIKDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009