<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14221 CA33344 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 96
2 3TC+D4T 91
3 DLV+NFV+SQV 65
4 DLV+NFV+RTV+SQV 138

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46L, V82VA   I15V, L63P, A71AV, I72EV  
>CA33344| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTILEEMNLPGRWKPKLIGGIGGFIKVRQYD
QIPIEICGHKVEGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215CY       V60VI, I135V, A158S, S162SC, T286A, I293IV  
>CA34359| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPSIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005