<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3955 CA33338 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 66
2 AZT+DDI 59
3 None 68
4 3TC+D4T+IDV 61
5 D4T+DDI+EFV 11
6 D4T+DDI+EFV+NFV 11
7 D4T+DDI+RTV+SQV 72
8 APV+D4T+DDI 63

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, G48GV, V82A, I84V, L90LM   L10I, K20I, L63C, A71V, V77I, T91TS  
>CA33338| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGFIKVRQYD
QICIEICGHKVIGTVLIGPTPANVIGRNLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N   V35M, T39A, V118I, T139M, A158S, Q207K, R211N, A272P, Q278H, I293V, E297A  
>CA34341| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRKHLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGTKALTEVVPLTAEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005