<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7984 CA33337 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 13
2 3TC+D4T+NFV 44
3 3TC+D4T+NFV+NVP 21
4 APV+D4T+RTV 79
5 3TC+APV+D4T+RTV 52
6 3TC+APV+DDI+EFV+LPV+TDF 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M   I13IV, I15IV, K20I, N37S, K55KR, R57K, I62V, L63P, A71V, T74S, V77I, I93L M36K_M
>CA33337| codons 1-99
PQITLWQRPLVTVKVGGQLIEALLDTGADDTVLEEKSLPGRWKPKIIGGIGGFMRVKQYD
QVPIEICGHKVIGSVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   Y181C V108I T39TA, S68SG, R83K, K101KR, K122P, D177E, V179VI, T200A, R211RK, H221HY, L228LR, D250E, A272P, E291D  
>CA34340| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLRKKKSVTILDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
CQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKYQKEPPFRWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVIPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005