<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DEURF10UG016 DEURF10UG016 Uganda 2010 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16A, E35D, M36I, R41K, R57K, L63I, H69Q, L89M  
>DEURF10UG016| codons 1-99
PQITLWQRPIVTVKIAGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIIIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I5V, K11T, K20R, V21I, V35T, V60I, K122E, D123N, S163T, K173S, Q174K, D177E, V179I, T200I, I202V, Q207A, R211T, V245K, E248D, K281R, T286A, E291D, P294T, E312N, G335D, M357K, G359S, K366R, T369A, A371V, I375V, A376V, T377M, T386A, E396D, A400T, T403M, E404D, E432D, D471E, Q480H, L491S, K512R, S519N, Q524K, K527G, E529D, A534S, A554S  
>DEURF10UG016| codons 1-560
PISPVETVPVTLKPGMDGPRIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRIKVEELRAHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDVITLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLAEVVQKVVMESIVIWGKAPKFKLPIQKDTWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIGKDKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V31I, K34R, I60M, I72V, T112V, I113V, T124A, T125A, V126F, G134N, I135V, K136Q, F139Y, D167E, V201I, T218S, L234I S283G
>DEURF10UG016| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPIVAREIVASCDKCQLKGEAMHGQVDCSPGM
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAFKAACWWANVQQEYGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQISKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Hora, B Genetic characterization of a panel of diverse HIV-1 isolates at seven international sites. PLoS ONE, 2015