<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14192 CA33304 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 48
2 D4T+DDI 17
3 AZT 39
4 3TC+AZT+IDV 35
5 D4T+DDI+NVP 26
6 D4T+DDI+NFV 35
7 3TC+RTV+SQV 57
8 3TC+ABC+EFV+RTV+SQV 158

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, K14R, K20V, L63P, A71IV, V77I, I93L  
>CA33304| codons 1-99
PQITLWQRPIVTIRIGGQLVEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKIISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74I, L210W, T215Y K219R Y181C, G190S   T7TA, K11R, V21I, K43E, E44A, R83K, K101Q, V118I, K122E, R172K, D177E, V179I, G196E, R211K, D218E, L228R, T286P, A288S, I293V, E297R  
>CA34319| codons 1-301
PISPIEAVPVRLKPGMDGPKIKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSDKWRKIVDFRELNKKTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPEIII
CQYMDDLYVSSDLEIEQHRTKIEELRQHLWKWGFYTPERKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGPKSLTEVVPLTREAE
L

References
Author Title Citation
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005